PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5108	ITRA_SOYBN	--NA--	"Glycine max"	Fabaceae	--NA--	Signaling-peptide	"3D-structure; Direct protein sequencing; Protease inhibitor; Serine protease inhibitor; Signal | Trypsin inhibitor A precursor (Kunitz-type trypsin inhibitor A)."	--NA--	DKESLAKKNHGLSRSEEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLERVSDDGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKMKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAF	216	"Experimental evidence at protein level"	24005.29	23990.09	4.95	--NA--	"FUNCTION:Inhibition of trypsin.MISCELLANEOUS:The sequence of variant A is shown.MISCELLANEOUS:Electrophoresis identifies three genetically distinct variants, A, B, and C, that are inherited as codominant alleles.SIMILARITY:Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family.CAUTION:Ref.4 sequence was originally thought to be rat caltrin.A number of peptide fragments were derived from a trypsin digest of caltrin and soybean trypsin inhibitor was used to stop the digestion. It appears that some of the inhibitor was also digested and sequenced."