PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5096	MEP1_SOYBN	--NA--	"Glycine max"	Fabaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Hydrolase; Metal-binding; Metalloprotease; Protease; Signal; Zinc; Zymogen | Metalloendoproteinase 1 precursor (EC 3.4.24.-) (SMEP1)."	--NA--	DINTLKQIMTPRCGVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLDLESVAVHEIGHLLGLGHSSDLRAIMYPSIPPRTRKVNLAQDDIDGIRKLKNHGDPYPFDGPGGILGHAFAPTDGRCHFDADEYWVASGDVTKSPVTSAFMTLRNHQELLVALATLYFLATSLPSVSAHGPYAWDGEATYKFTTYHPGQNTYAFSPEPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASYGINPYKGLSNVKNYFHHLGYIPNAPHFDDNFDDTLVSAIKTYQKNYNLNVTGKF	305	"Experimental evidence at protein level"	34044.33	34022.94	6.31	--NA--	"FUNCTION:Specificity similar to that of mammalian matrix metalloproteases. May act against cell wall components.COFACTOR:Binds 1 zinc ion per subunit (By similarity).DOMAIN:The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme.The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.SIMILARITY:Belongs to the peptidase M10A family."