PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5094	LEC2_MEDTR	--NA--	"Medicago truncatula"	Fabaceae	--NA--	Signaling-peptide	"Calcium; Glycoprotein; Lectin; Manganese; Metal-binding; Signal | Truncated lectin 2 precursor."	--NA--	DILSWSFDSKLNLGFENNINANVSSSTQAAKTASTGKLELSKAVKNSIGRALYSAPIHIWDSKTGSVANFQTTFTFTITAMSSSNFSCILSISLTFFILLLNKVNSAETTSFSITKFVPDQKNLIFQGDANGATNVLSVDVEYPLIRHYTLSHVVPLKDVVPEWVRIGFSSSTGAEYSAHPNTYNVADGLAFFIAPIDTKPKSIHHGGYLGVFDSKTYKKSIQTVAVEIDTFYNAQWDPNPGNISSTGRHIGIDVNSIKSISTVPWSLENNKKANVAIGF	280	"Protein inferred from homology"	30473.35	30454.57	7.97	--NA--	"MISCELLANEOUS:Lec2 is probably non functional, since a frameshift mutation leads to premature translation termination after only 98 AA. The sequence below ignores this frameshift mutation.MISCELLANEOUS:Binds one manganese (or other transition metal) ion and one calcium ion. The metal ions are essential for the saccharide-binding and cell-agglutinating activities.SIMILARITY:Belongs to the leguminous lectin family."