PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5087	XIP1_WHEAT	--NA--	"Triticum aestivum"	Poaceae	--NA--	Signaling-peptide	"3D-structure; Direct protein sequencing; Glycoprotein; Plant defense; Secreted; Signal | Xylanase inhibitor protein 1 precursor (XIP-1) (XIP-I) (Class III,chitinase homolog).Secreted (Potential)."	--NA--	DGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGKYYALREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIMAPLAARRPACLLALLSVAAALFLTPTALAAGGKTGQVTVFWGRNKAEGSVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWL	304	"Experimental evidence at protein level"	33274.73	33253.61	8.67	--NA--	"FUNCTION:Fungal xylanase inhibitor. Possesses competitive inhibiting activity against fungal endo-1,4-beta-D-xylanases belonging to glycoside hydrolase family 10 (GH10) and family 11 (GH11). Possesses also inhibitory activity towards barley alpha- amylases. Binding to xylanases or amylases is necessary for inhibition activity. May function in plant defense against secreted fungal pathogen xylanases. Is similar to class III chitinases, but does not exhibit chitinase activity.SUBUNIT:Binds to fungal GH10 and GH11 xylanases. Forms also a ternary complex with barley alpha-amylase 1 (AMY1) and insoluble starch.DEVELOPMENTAL STAGE:Expressed in immature embryos 3 weeks after pollination, in roots and shoots of 3 day and 5 day old seedlings, and in roots of 10 day old seedlings.INDUCTION:By wounding, methyl jasmonate, and by E.graminis infection in leaves.SIMILARITY:Belongs to the glycosyl hydrolase 18 family. Xylanase inhibitor subfamily."