PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5070	PER50_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Biological rhythms; Calcium; Complete proteome; Glycoprotein; Heme; Hydrogen peroxide; Iron; Metal-binding; Oxidoreductase; Peroxidase; Pyrrolidone carboxylic acid; Secreted; Signal | Peroxidase 50 precursor (EC 1.11.1.7) (Atperox P50) (PRXR2) (ATP9a).Secreted (By similarity)."	--NA--	DGFDTVIKAKEALDAVPNCRNKVSCADILTMATRDVVNLAGGPQYDVELGFAHCTKVFNRIYTFNKTTKVDPTVNKDYVTELKASCPRNIDPRVAINMDPFINSMIKLGRVGVKTGSNGNIRRDCGAFNMVVVNKTNLLLLLLSLCLTLDLSSAQLRRNFYAGSCPNVEQIVRNAVQKKRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGAHTLGTTPRQFDNVYYKNLQQGKGLFTSDQVLFTDRRSKPTVDLWANNGQLFNQAVQQTFTTIPATLRLYFHDCFVNGCDASVMIASTNNNKAEKDHEENLSLAG	329	"Experimental evidence at protein level"	36076.16	36053.36	8.9	--NA--	"FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.FUNCTION:Exhibits a Ca(2)-pectate binding affinity which could be interpreted in vivo as a specificity to interact with the pectic structure of the cell wall.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit (By similarity).COFACTOR:Binds 2 calcium ions per subunit (By similarity).TISSUE SPECIFICITY:Expressed in roots and leaves.DEVELOPMENTAL STAGE:Up-regulated during leaf development.INDUCTION:Enhanced expression in response of mechanical wounding.Induced either by incompatible fungal pathogen attack, or by methyl jasmonate, a plant defense-related signaling molecule.Expressed under a diurnal rhythm (circadian clock control).MISCELLANEOUS:There are 73 peroxidase genes in A.thaliana.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily."