PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5041	OXO2_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Glycoprotein; Manganese; Metal-binding; Oxidoreductase; Secreted; Signal; Stress response | Oxalate oxidase 2 precursor (EC 1.2.3.4) (Germin).Secreted, extracellular space, apoplast (By similarity). Secreted, cell wall (By"	--NA--	DFAPGGTNPPHVHPRATEIGIVMKGELLVGILGSLDSGNKLYSRVVRAGEMGYSKTLAVSLFAVLLLAPAVLASDPDPLQDFCVADLDGKAVSVNGHPCKPMSEAGDDFLFSSKLAKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVTFLIPRGLMHFQFNVGKTEASMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLTKALRVEAGVVELLKSKFAAGF	224	"Experimental evidence at transcript level"	23479.09	23464.16	6.09	--NA--	"FUNCTION:Releases hydrogen peroxide in the apoplast. May play an important role in several aspects of plant growth and defense mechanisms.CATALYTIC ACTIVITY:Oxalate O(2) 2 H() = 2 CO(2) H(2)O(2).SUBUNIT:Oligomer (believed to be a pentamer but probably hexamer) (By similarity).TISSUE SPECIFICITY:Root.INDUCTION:By salt stress.PTM:Glycosylated. A form called G contains antennary GlcNAc residues, whereas a form called G' lacks antennary GlcNAc residues in its otherwise identical glycans.SIMILARITY:Belongs to the germin family."