PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5039	GER3_WHEAT	--NA--	"Triticum aestivum"	Poaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Cytoplasm; Glycoprotein; Manganese; Metal-binding; Oxidoreductase; Secreted; Signal | Oxalate oxidase GF-3.8 precursor (EC 1.2.3.4) (Germin GF-3.8).Secreted, extracellular space, apoplast."	--NA--	DFAPGGTNPPHIHPRATEIGIVMKGELLVGILGSLDSGNKLYSRVVRAGEMGYSKNIASGMFAMLLLASAVLSSNPHPLQDFCVADLDGKAVSVNGHMCKPMSEAGDDFLFSSKLAKAGNTSTPNGSAVTDLNVAEWPGTNTLGVSMNRVTFLIPRGLMHFQFNVGKTEASMVVFFNSQSPSVVFVPLTLFGSNPPIPKPVLTKALRVEAGVVELLKSKFAGGS	224	"Experimental evidence at protein level"	23562.24	23547.08	8.59	--NA--	"FUNCTION:Produces developmental and stress-related release of hydrogen peroxide in the apoplast. May play an important role in several aspects of plant growth and defense mechanisms.CATALYTIC ACTIVITY:Oxalate O(2) 2 H() = 2 CO(2) H(2)O(2).SUBUNIT:Oligomer (believed to be a pentamer but probably hexamer) (By similarity).Cytoplasm. Secreted, cell wall. Note=Found in the apoplast and the cytoplasm of germinating embryo cells. Associated with the cell wall.MISCELLANEOUS:Associated mostly with highly substituted forms of glucuronogalactoarabinoxylans.SIMILARITY:Belongs to the germin family."
