PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5037	GLP1_SINAL	--NA--	"Sinapis alba, Brassica hirta"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Glycoprotein; Manganese; Metal-binding; Secreted; Signal | Germin-like protein 1 precursor.Secreted, extracellular space, apoplast."	--NA--	DFAFSGLGKAGNTSNVIKAAVTPAFAPAFAGLNGLDVSLARLDLAGGGVIKKLKGVLGGTNMKMRIQIFFILSLFSSISFASVQDFCVADPKGPQNPSGYSCKNPDQVTENPLHTHPGASEVLVVIQGTICAGFISSANKVYLKTLSRGDSMVFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEV	211	"Experimental evidence at transcript level"	21998.28	21984.36	6.32	--NA--	"FUNCTION:May be involved in the maturation of walls of growing cells.SUBUNIT:Oligomer (believed to be a pentamer but probably hexamer) (By similarity).Secreted, cell wall.TISSUE SPECIFICITY:Epidermis and spongy parenchyma of young leaves and epidermis and cortex of stems and petioles.SIMILARITY:Belongs to the germin family."