PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_5004	AMY3_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"Calcium; Carbohydrate metabolism; Germination; Glycosidase; Hydrolase; Metal-binding; Signal | Alpha-amylase type B isozyme precursor (EC 3.2.1.1) (1,4-alpha-D-,glucan glucanohydrolase) (Clone PHV19) (Fragment)."	--NA--	DDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGADRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELAEWLNWLKADIGFDGWDWGLKEEIDRLVSVRTGAELVNWVDKVGGKGPATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWLHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGVTPDARLDWGPHMICRDMANKHLSLSLFLVLLGLSASLASGQVLFQGFNWESWKHNGGWYNFLMGKVRFDFAKGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFF	368	"Experimental evidence at transcript level"	40787.02	40761.28	5.79	--NA--	"CATALYTIC ACTIVITY:Endohydrolysis of 1,4-alpha-D-glucosidic linkages in oligosaccharides and polysaccharides.COFACTOR:Binds 3 calcium ions per subunit (By similarity).SUBUNIT:Monomer (By similarity).DEVELOPMENTAL STAGE:Production of alpha-amylase is hormonally regulated. Germinating embryos produce the hormone gibberellic acid, which within 10 hours stimulates the aleurone cells covering the endosperm of the seed to produce alpha-amylase. The enzyme then degrades the starch within the endosperm for use by the developing plant embryo.MISCELLANEOUS:There are at least 4 types of alpha-amylase in barley.MISCELLANEOUS:Type B isozyme mRNA is undetectable in unstimulated cells and increases a hundred-fold after stimulation with gibberellic acid.SIMILARITY:Belongs to the glycosyl hydrolase 13 family."
