PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4976	ITRF_MAIZE	--NA--	"Zea mays"	Poaceae	--NA--	Signaling-peptide	"3D-structure; Direct protein sequencing; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Trypsin/factor XIIA inhibitor precursor (Hageman factor inhibitor),(CHFI).Secreted."	--NA--	DAQLEGRLEDLPGCPREVQRGFAATLVTEAECNLATISGVAECPWILGGGMASSSSSSHRRLILAAAVLLSVLAAASASAGTSCVPGWAIPHNPLPSCRWTMPSKYVTSRTCGIGPRLPWPELKRRCCRELADIPAYCRCTALSILMDGAIPPGP	155	"Experimental evidence at protein level"	16301.92	16291.16	8.12	--NA--	"FUNCTION:Potent inhibitor of mammalian trypsin and a specific inhibitor of factor XIIa (activated hageman factor).SUBUNIT:Monomer.MISCELLANEOUS:The sequence heterogeneity suggests that 2 genes exist for this inhibitor. The genes may be alleles, or multiple loci could exist.SIMILARITY:Belongs to the protease inhibitor I6 (cereal trypsin/alpha-amylase inhibitor) family."