PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4974	CCDP_MAIZE	--NA--	"Zea mays"	Poaceae	--NA--	Signaling-peptide	"Glycoprotein; Repeat; Signal | Cortical cell-delineating protein precursor (Root-specific protein,ZRP3)."	--NA--	DALKLKVCAKVLGLVKVGLPQYEQCCPLLEGLVDLDAALCLCTAIKANVLGIHLNVPLSLNFILNNCGRICPEDFTCPNMAPKVALFLALSLLFAATAHGCEPNCSGPVVPTPPVVPTPSSHSHGRCPI	129	"Experimental evidence at transcript level"	13526.13	13516.99	7.01	--NA--	"FUNCTION:Delineates a novel subset of developing cortical cells.It is probably involved in some aspect of transport of molecules to or from the vasculature.TISSUE SPECIFICITY:Cortical ground meristem of developing roots.SIMILARITY:To carrot DC2.15 and PEMB3."