PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4973	PER62_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Alternative splicing; Calcium; Complete proteome; Glycoprotein; Heme; Hydrogen peroxide; Iron; Metal-binding; Oxidoreductase; Peroxidase; Secreted; Signal | Peroxidase 62 precursor (EC 1.11.1.7) (Atperox P62) (ATP24a).Secreted (By similarity)."	--NA--	DAKRQLEAACPGVVSCADILALAARDSVSLTNGQSWQVPTGRRDGRVSLAFINLSRNRGILQSDHVLWTSPATRSIVQEFMAPRGNFNVQFARSMVKMSNIGVKTGTNGEIRRVCSAVNMGLVRSFALVIVFLSCLIAVYGQGTRIGFYSTTCPNAETIVRTTVASHFGRIFNSSGNTADPTMDQTFVPQLQRLCPQNGDGSARVDLDTGSGNTFDTSYSDPKVAPGLLRMHNHDCFVQGCDGSVLLSGPNSERTAGANVNLHGFEVIDSNVNNLPSPSDSLAIQQRKFSAFRLNTRDLVTLVGGGHTIGTAACGFITN	319	"Experimental evidence at transcript level"	34133.54	34112.05	8.81	--NA--	"FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit (By similarity).COFACTOR:Binds 2 calcium ions per subunit (By similarity).ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences; Name=1; IsoId=Q9FKA4-1; Sequence=Displayed;TISSUE SPECIFICITY:Mainly expressed in roots.INDUCTION:Transiently induced a few minutes after mechanical wounding.MISCELLANEOUS:There are 73 peroxidase genes in A.thaliana.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily."