PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4935	XTH24_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Xyloglucan endotransglucosylase/hydrolase protein 24 precursor,(EC 2.4.1.207) (At-XTH24) (XTH-24) (Meristem protein 5) (MERI-5,protein) (MERI5 protein) (Endo-xyloglucan transferase) (Xyloglucan,endo-1,4-beta-D-glucanase).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl"	--NA--	CTDHRRFPQGAPKECTTSSDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAGTVTTFYLKSEGSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFHTYSILWNPQMSPFKIFFFTTLLVAAFSVSAADFNTDVNVAWGNGRGKILNNGQLLTLSLRIILTVDDTPIREFKNYESLGVLFPKNKPMRMYASLWNADDWATRGGLVKTDWSKAPFMASYRNIKIDSKPNSNWYTQEMDSTSQARLKWVQKNYMIYNY	269	"Experimental evidence at protein level"	30755.67	30736.08	8.39	--NA--	"FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.May be required during development to modify the walls of cells under mechanical stress.CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.TISSUE SPECIFICITY:Highly expressed. Predominantly expressed in stems. Expressed in shoot apical meristems, also found in seedlings and meristems.INDUCTION:May be transcriptionally regulated by ANGUSTIFOLIA.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).PTM:N-glycosylated; essential for its enzymatic activity.SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 2 subfamily.SEQUENCE CAUTION:Sequence=AAA32828.1; Type=Frameshift; Positions=158, 178, 183, 189, 190, 194, 199; Sequence=CAA79012.1; Type=Frameshift; Positions=93, 104;WEB RESOURCE:Name=XTH-World; URL=""http://labs.plantbio.cornell.edu/XTH/""; "