PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4919	THN3_VISAL	--NA--	"Viscum album"	Santalaceae	--NA--	Signaling-peptide	"3D-structure; Direct protein sequencing; Plant defense; Plant toxin; Secreted; Signal; Toxin | Viscotoxin-A3 precursor [Contains: Viscotoxin-A3; Acidic protein].Secreted."	--NA--	CSDLCQDVDDAMEVVRGSSLVLLVLLLGALLVSQVESKSCCPNTTGRNIYNACRLTGAPRPTCAKLSGCKIISGSTCPSDYPKFYCTLGCESSQCATNSNGDAEAVRCKTA	111	"Experimental evidence at protein level"	11620.31	11612.5	6.32	--NA--	"FUNCTION:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.SIMILARITY:Belongs to the plant thionin (TC 1.C.44) family."