PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4916	THN23_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Plant defense; Plant toxin; Secreted; Signal; Toxin | Probable thionin-2.3 precursor [Contains: Probable thionin-2.3; Acidic,protein].Secreted (Potential)."	--NA--	CSAESGCRDTYVGYCPSGFPYGSLTNSGDVVNVYCKLGCVSSLCGALTSLMEGKTVIFSVLVMGLVISQIQVEAQKTCCPSQSTRKEFEDCISEGNLQILQKLDTSGKVNVAVERCTKACSTICTKGSKTAVETV	135	"Experimental evidence at transcript level"	14259.4	14249.88	6.4	--NA--	"FUNCTION:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.SIMILARITY:Belongs to the plant thionin (TC 1.C.44) family."
