PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4909	DEF1_CAPAN	--NA--	"Capsicum annuum"	Solanaceae	--NA--	Signaling-peptide	"Antimicrobial; Direct protein sequencing; Fungicide; Plant defense; Secreted; Signal | Defensin J1-1 precursor.Secreted."	--NA--	CRREGFTDGSCIGFRLQCFCTKPCAMAGFSKVVATIFLMMLLVFATDMMAEAKICEALSGNFKGLCLSSRDCGNV	75	"Experimental evidence at protein level"	8117.69	8111.83	8.2	--NA--	"FUNCTION:Plant defense peptide with antifungal activity against F.oxysporum and B.cinerea.SUBUNIT:Monomer.TISSUE SPECIFICITY:Expressed in orange and red ripe fruit and to a lesser extent in mature, green fruit. Present in trace in young, green fruit.DEVELOPMENTAL STAGE:Transcripts remains very low during fruit development and dramatically increases during ripening.INDUCTION:By wounding.SIMILARITY:Belongs to the plant defensin family."