PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4900	PER2_ARMRU	--NA--	"Armoracia rusticana, Armoracia laphatifolia"	Brassicaceae	--NA--	Signaling-peptide	"Calcium; Glycoprotein; Heme; Hydrogen peroxide; Iron; Metal-binding; Oxidoreductase; Peroxidase; Pyrrolidone carboxylic acid; Secreted; Signal; Vacuole | Peroxidase C2 precursor (EC 1.11.1.7).Secreted (Probable). Vacuole (Probable)."	--NA--	CQFIMDRLYNFSNSGKPDPTLDKSYLSTLRKQCPRNGNLSVLVDFDLRTPFDVIDTMKAAVEKACPKTVSCADLLAIAAQKSVVLAGGPSWKVPSGRRDSFVEAMIRMGNLSPSTGKQGEIRLNCRVVNSKPKIMDVVDTNDFASSILRGFMDLANDNLPGPSSTLQVLKDKFRNVGLDRPSDLVALSGGHTFGKNQMHSSSSLIKLGFLLLLLNVSLSHAQLSPSFYDKTCPQVFDIATNTIKTALRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNARSARGTIFDNKYYVNLKENKGLIQSDQELFSSPDASDTIPLVRAYADGQGKFFDA	347	"Protein inferred from homology"	38035.38	38011.33	8.71	--NA--	"FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 2 calcium ions per subunit.COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit.Note=Carboxy-terminal extension appears to target the protein to vacuoles.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily."
