PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4884	IER1_SOLLC	--NA--	"Solanum lycopersicum, Lycopersicon esculentum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Ethylene-responsive proteinase inhibitor 1 precursor (Ethylene-,responsive proteinase inhibitor I).Secreted (Potential)."	--NA--	CPGVTKESWPELLGTPAKFAKQIIQKENPKLTNVETLLNGSAFTEDLRCNMEANKSMVKLVAFLIILVSSCFQSLTAQDLEIEVSDGLNVLQVHDVSQSFRVRLFVNLLDIVVQTPKVG	119	"Protein inferred from homology"	13160.31	13151.94	5.33	--NA--	"SIMILARITY:Belongs to the protease inhibitor I13 (potato type I serine protease inhibitor) family."