PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4878	GLU2_MAIZE	--NA--	"Zea mays"	Poaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Membrane; Repeat; Seed storage protein; Signal; Storage protein; Vacuole | Glutelin-2 precursor (Zein-gamma) (27 kDa zein) (Alcohol-soluble,reduced glutelin) (ASG) (Zein Zc2).Vacuole, aleurone grain membrane."	--NA--	CPCQQPHPSPCQLQGTCGVGSTPILGQCVEFLRHQCSPTATPYCSPQCQSLRQQCCQQLRQVEPQHRYQAIFGLVLQSILQQQPQSGQVAGLLAAQIAQQLTAMCGLQQPTPCPYAAAGGVPHMRVLLVALALLALAASATSTHTSGGCGCQPPPPVHLPPPVHLPPPVHLPPPVHLPPPVHLPPPVHLPPPVHVPPPVHLPPPPCHYPTQPPRPQPHPQPHP	223	"Experimental evidence at protein level"	23688.67	23672.97	8.41	--NA--	"FUNCTION:Seed storage protein. It accounts for about 15% of the total endosperm protein content.Note=Border of the inner part of the membrane of endosperm protein bodies.SIMILARITY:Belongs to the gliadin/glutenin family."