PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4855	KAB7_OLDAF	--NA--	"Oldenlandia affinis"	Rubiaceae	--NA--	Signaling-peptide	"Cytolysis; Direct protein sequencing; Hemolysis; Knottin; Plant defense; Signal | Kalata-B7 precursor."	--NA--	CKRNGLPDVAADKLFLRKMKSSETTLTMFLKEMQLKGLPVCGETCTLGTCYTQGCTCSWPIMAKFTNCLALCLLLAAVVGAFGVELSEADKSAVVNEIAEKMALQEMLDGV	111	"Experimental evidence at protein level"	11959.2	11950.94	5.39	--NA--	"FUNCTION:Probably participates in a plant defense mechanism. Has hemolytic activity.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin (By similarity).PTM:Kalata-B7 is a cyclic peptide.MASS SPECTROMETRY:Mass=3071.6; Method=Electrospray; Range=76-104; Source=PubMed:17534989;SIMILARITY:Belongs to the cyclotide family. Moebius subfamily."