PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4854	SCRA_ARALY	--NA--	"Arabidopsis lyrata"	Brassicaceae	--NA--	Signaling-peptide	"Self-incompatibility; Signal | S locus cysteine-rich-like protein a precursor."	--NA--	CKRDLTEDGNNPSKCRCRFRAGRRHCRCIYCEVFGMMRCSVLFVVSYVIMSLLISHVQGMEDQKWKKVCNLEGNFPGRCVGNGDEQ	86	"Experimental evidence at transcript level"	9910.55	9903.69	8.82	--NA--	"FUNCTION:Involved in self-incompatibility.TISSUE SPECIFICITY:Expressed specifically in anthers.SIMILARITY:Belongs to the SCRL protein family."