PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4844	TLP1_PRUPE	--NA--	"Prunus persica"	Rosaceae	--NA--	Signaling-peptide	"Plant defense; Secreted; Signal | Thaumatin-like protein 1 precursor (PpAZ44).Secreted (Potential)."	--NA--	CKASTCPADINKVCPAPLQVKGSDGSVIACKSACLAFNQPKYCCTPPNDKMMKSQAALLGLTTLAILFFSGAHAAKITFTNKCSYTVWPGTLTGDQKPQLPETCPPPDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPAYLITFCPSLTGFELATGISRSVDAPSPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAAPPATLVEITIASNGGQDFYDVSLVDGFNLPMSVAPQGGTGK	246	"Experimental evidence at transcript level"	25765.28	25748.3	8.3	--NA--	"FUNCTION:May be involved in protecting plant tissues from pathogen infection.TISSUE SPECIFICITY:Equally expressed in the abscission zone and surrounding tissues of both fruitlets and leaves.DEVELOPMENTAL STAGE:Expressed during fruit ripening but absent in senescent leaves.INDUCTION:Up-regulated in a tissue-indepent manner following treatment with propylene and wounding due to embryoctomy.SIMILARITY:Belongs to the thaumatin family."