PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4832	ALB1_GLYSO	--NA--	"Glycine soja"	Fabaceae	--NA--	Signaling-peptide	"Knottin; Plant toxin; Seed storage protein; Signal; Storage protein; Toxin | Albumin-1 precursor (A1) [Contains: Albumin-1 chain b (A1b),(Leginsulin); Albumin-1 chain a (A1a)]."	--NA--	CIHPTGLSSVAKMVDEHPNLCQSDDECMKKGSGNFCARYPNNYIDYGWCFDSDSEALKGFLAMPRATTKMAVFLLATSTIMFPTKIEAADCNGACSPFEVPPCRSSDCRCVPIGLFVGF	119	"Protein inferred from homology"	12962.91	12953.96	5.2	--NA--	"FUNCTION:A1b binds to basic 7S globulin (BG) and stimulates its phosphorylation activity (By similarity).DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin (By similarity).PTM:The C-terminal glycine may be removed from A1b."