PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4831	ALB1_SOYBN	--NA--	"Glycine max"	Fabaceae	--NA--	Signaling-peptide	"3D-structure; Knottin; Plant toxin; Seed storage protein; Signal; Storage protein; Toxin | Albumin-1 precursor (A1) [Contains: Albumin-1 chain b (A1b),(Leginsulin); Albumin-1 chain a (A1a)]."	--NA--	CIHPTGLSSVAKMIDEHPNLCQSDDECMKKGSGNFCARYPNNYIDYGWCFDSDSEALKGFLAMPRATTKMAVFLLATSTIMFPTKIEAADCNGACSPFEVPPCRSRDCRCVPIGLFVGF	119	"Experimental evidence at protein level"	13046.04	13037.04	5.58	--NA--	"FUNCTION:A1b binds to basic 7S globulin (BG) and stimulates its phosphorylation activity. Involved in the signal transduction system to regulate the growth and differentiation as a hormone peptide.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.PTM:The C-terminal glycine may be removed from A1b."