PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4813	EXB10_MAIZE	--NA--	"Zea mays"	Poaceae	--NA--	Signaling-peptide	"Allergen; Cell wall; Cell wall biogenesis/degradation; Direct protein sequencing; Glycoprotein; Membrane; Secreted; Signal | Expansin-B10 precursor (ZmEXPB10) (Beta-expansin-10) (Pollen allergen,Zea m 1c).Secreted, cell wall; Peripheral membrane protein (By similarity)."	--NA--	CGSCFEIKCDKPVECSGKPVVVHITDMNYEPIAAYHFDLAGTAFGAMAKKGDIVAVDVKEKGSDTYEPLKHSWGAIWRKDSDKPLKGPLTVRLTTEGGTKGEEEKLRKAGIIDMQFRRVKCKYDSKVTFHLEKGCGPNYLALLVKYVDGDLDAKATWYGKPTGAGPDDNGGGCGYKDVNKPPFNSMGACGNIPIFKDGLGMAVNVRTMWSSMRAQVAMVVALVFLVRGAWCGPPKVPPGKNITATYGKDWSVYDDVIPANWKANTAYTAK	270	"Experimental evidence at protein level"	29341.81	29322.67	8.82	--NA--	"FUNCTION:May aid fertilization by loosening the cell wall of the stigma and style, thereby facilitating penetration of the pollen tube. Acts selectively on grass cell walls, which are relatively poor in pectins and xyloglucans and rich in glucuronoarabinoxylans and (1-3),(1-4)-beta-D-glucans, when compared with cell walls of other angiosperms, including other monocots (By similarity).TISSUE SPECIFICITY:Expressed in pollen.ALLERGEN:Causes an allergic reaction in human. Causes maize pollen allergy (By similarity).SIMILARITY:Belongs to the expansin family. Expansin B subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain. "