PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4797	NLTP2_SOLLC	--NA--	"Solanum lycopersicum, Lycopersicon esculentum"	Solanaceae	--NA--	Signaling-peptide	"Lipid-binding; Signal; Stress response; Transport | Non-specific lipid-transfer protein 2 precursor (LTP 2)."	--NA--	CGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIMEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCPYKISPSTDCSTVQ	114	"Experimental evidence at transcript level"	11484.5	11476.64	8.09	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.INDUCTION:By abscisic acid (ABA) and drought stress.SIMILARITY:Belongs to the plant LTP family."