PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4784	SCR22_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Signal | Protein SCRL22 precursor."	--NA--	CFKEMESKYQQRFLQCTCKNLKPEPKSPKDEHDCTCQRANPYECNSMWCTTLFMVSCVSICLILSHVQEVEAGAPPQDCWNLVTFPAKCGIHGKKK	96	"Experimental evidence at transcript level"	10990.8	10983.13	8.05	--NA--	"TISSUE SPECIFICITY:Expressed at least in stem, root, rosette leaves and flower buds.SIMILARITY:Belongs to the SCRL protein family."