PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4781	P322_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Serine protease inhibitor; Signal | Probable protease inhibitor P322 precursor."	--NA--	CETERFSGGNCHGFRRRCFCTKPCMRFFATFFLLAMLVVATKMGPMRIAEARHCESLSHRFKGPCTRDSNCASV	74	"Experimental evidence at transcript level"	8413.89	8407.96	9.33	--NA--	"TISSUE SPECIFICITY:Tuber.SIMILARITY:Belongs to the plant defensin family."