PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4773	IBB2_PEA	--NA--	"Pisum sativum"	Fabaceae	--NA--	Signaling-peptide	"Protease inhibitor; Serine protease inhibitor; Signal | Seed trypsin/chymotrypsin inhibitor TI5-72 precursor."	--NA--	CDTCLCTKSDPPTCRCVDVGETCHSACDSCICALSYPPQCQCFDTHKFCYKACHNSEVEEVIKNMELMNKKVMMKLALMVFLLSFAANVVNARFDSTSFITQVLSNGDDVKSAC	114	"Experimental evidence at transcript level"	12597.62	12588.69	5.48	--NA--	"FUNCTION:Inhibitor of trypsin and of chymotrypsin. May function as a natural phytochemical defense against predators.TISSUE SPECIFICITY:Seed.SIMILARITY:Belongs to the Bowman-Birk serine protease inhibitor family."