PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4759	PERN1_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"Calcium; Direct protein sequencing; Glycoprotein; Heme; Hydrogen peroxide; Iron; Metal-binding; Oxidoreductase; Peroxidase; Polymorphism; Pyrrolidone carboxylic acid; Secreted; Signal | Peroxidase N1 precursor (EC 1.11.1.7) (Peroxidase B2) (Peroxidase B3).Secreted (By similarity)."	--NA--	CAVIRDRLFNFNSTGGPDPSIDATFLPQLRALCPQNGDASRRVGLDTGSVDGRVSRAADAGDLPAFFDSVDIQKRKFLTKGLNTQDLVALTGAHTIGTAGEFGRSMVKMSNIEVKTGTNGEIRKVCSAINKGFDVIEDAKTQIEAICPGVVSCADILALAARDSVVATRGLTWSVPTGRRMEYYHHSINKMAMFMVILVLAIDVTMVLGQGTRVGFYSSTCPRAESIVQSNNFDTSYFSNLRNGRGVLESDQKLWTDASTQVFVQRFLGIRGLLGLTFGVTVRAHFQSDPTVAPGILRMHFHDCFVLGCDGSILIEGSDAERTAIPNRNL	330	"Experimental evidence at protein level"	35731.77	35709.1	7.73	--NA--	"FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue. Can use NADH, NADPH and monolignols as substrates.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 2 calcium ions per subunit (By similarity).COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit (By similarity).BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Optimum pH is 4.7;TISSUE SPECIFICITY:Expressed at a high level in roots and at a trace level in lower leaves. Not expressed in upper leaves, stems, flowers, seeds and shoot apices.INDUCTION:Induced rapidly in leaves after wounding, mRNA is detectable 30 minutes after wounding, reaches maximum levels after 4 hours, and decreases slightly after 8 hours. When lower leaves are wounded, mRNA also accumulates in upper, unwounded, leaves.Wound-induced expression is enhanced by spermine, and suppressed by methyl jasmonite and coronatine. Salicylic acid and ethephon have no effect on wound-induced expression. Induced by infection with TMV.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily."