PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4719	XTH14_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Xyloglucan endotransglucosylase/hydrolase protein 14 precursor,(EC 2.4.1.207) (At-XTH14) (XTH-14).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl"	--NA--	AWDEIDFEFLGNRTGHPYTIHTNVFTGGKGDREMQFRLWFDPTADFHTYTEGGRVKIDWSNAPFKASYRNFNDQSSCSRTSSSKWVTCEPNSNSWMWTTLLLTCTLDKVSGSGFQSKKEYLFGKIDMKLKLVAGNSAGTVTAYYLSSKGTMACFATKQPLLLSLLLAIGFFVVAASAGNFYESFDITWGNGRANIFENGQNPAQYGKMMWVQRDFMIYNYCTDFKRFPQGLPKECKLVHWNPVNIIFLVDGIPIRVFKNNEKNGVAYPKNQPMRIYSSLWEADDWAT	287	"Experimental evidence at protein level"	32740.16	32719	8.63	--NA--	"FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.Has some preference for non-fucosylated xyloglucan polymer.CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.TISSUE SPECIFICITY:Root specific.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).PTM:N-glycosylated; not essential for its enzymatic activity.SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 2 subfamily.WEB RESOURCE:Name=XTH-World; URL=""http://labs.plantbio.cornell.edu/XTH/""; "