PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4704	NLTP2_GOSHI	--NA--	"Gossypium hirsutum, Gossypium mexicanum"	Malvaceae	--NA--	Signaling-peptide	"Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein precursor (LTP) (GH3)."	--NA--	AVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVKMASSMSLKLACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAG	120	"Experimental evidence at transcript level"	11816.89	11808.97	9.26	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.SIMILARITY:Belongs to the plant LTP family."