PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4654	AGP13_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Direct protein sequencing; Glycoprotein; GPI-anchor; Hydroxylation; Lipoprotein; Membrane; Proteoglycan; Signal | Arabinogalactan peptide 13 precursor (AG-peptide 13).Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	ATLAFGFLFMEAMKMRLFVAVLVAAMAFSAVQQAAAVEAPAPSPTSDASLAIPAFFASV	59	"Experimental evidence at protein level"	6052.18	6048.11	4.68	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.PTM:O-glycosylation with arabinogalactan occurs on noncontiguous hydroxyproline residues.SIMILARITY:Belongs to the AG-peptide AGP family."