PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4648	IP21_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"Protease inhibitor; Repeat; Serine protease inhibitor; Signal | Proteinase inhibitor type-2 precursor (Proteinase inhibitor type II)."	--NA--	ATISCPFSGLVKINQECINCCNADKGCELYDNDGSLICTGGEPQSAACTTCCAGYKGCNYYSANGTFICEGSSDPKNPNVCPQFCDPDIAYSKCPRSEGETIINPTGCTTCCTGYKGCYYFGQDGEFVCEGESDEPKSCTTECDPRVMAVHKVSFVAHLLVLGMFLLLVDAKACTKECGNFAYGICPRSQGTPDDPI	197	"Experimental evidence at transcript level"	20984.67	20970.21	4.49	--NA--	"INDUCTION:Locally induced in leaves subjected to different types of stress (TMV infection, wounding, UV irradiation).SIMILARITY:Belongs to the protease inhibitor I20 (potato type II proteinase inhibitor) family."