PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4645	IAAC3_WHEAT	--NA--	"Triticum aestivum"	Poaceae	--NA--	Signaling-peptide	"Alpha-amylase inhibitor; Direct protein sequencing; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Alpha-amylase/trypsin inhibitor CM3 precursor (Chloroform/methanol-,soluble protein CM3).Secreted."	--NA--	ATIHNVRYCPAVEQPLWIMACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNL	168	"Experimental evidence at protein level"	18221.28	18209.09	7.63	--NA--	"FUNCTION:Alpha-amylase/trypsin inhibitor. It could be involved in insect defense mechanisms.SUBUNIT:Subunit of the tetrameric inhibitor.TISSUE SPECIFICITY:Developing endosperm.PTM:Five disulfide bonds are present (Probable), which are essential for the inhibitor activity.MISCELLANEOUS:CM proteins would be involved in the cooking quality of pasta.SIMILARITY:Belongs to the protease inhibitor I6 (cereal trypsin/alpha-amylase inhibitor) family."