PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4640	PSK5_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Developmental protein; Differentiation; Direct protein sequencing; Growth factor; Secreted; Signal; Sulfation | Phytosulfokines 5 precursor (Secretory protein SH27A) [Contains:,Phytosulfokine-alpha (PSK-alpha) (Phytosulfokine-a); Phytosulfokine-,beta (PSK-beta) (Phytosulfokine-b)].Secreted (By similarity)."	--NA--	ATGNGDEVSELMGAAEEEAAGLCEEGNEECVERRMLRDAHLDYIYTQKRNMRPTGRRSSPPVAAALALLLLLVLFFFSHCASAARPLPASAAAELVLQDGRP	102	"Experimental evidence at protein level"	10985.47	10978.47	4.94	--NA--	"FUNCTION:Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation.PTM:Sulfation is important for activity and for the binding to a putative membrane receptor.PTM:PSK-alpha is produced by endopeptidase digestion. PSK-beta is produced from PSK-alpha by exopeptidase digestion.SIMILARITY:Belongs to the phytosulfokine family."
