PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4612	XTH11_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Cell wall biogenesis/degradation; Complete proteome; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Probable xyloglucan endotransglucosylase/hydrolase protein 11,precursor (EC 2.4.1.207) (At-XTH11) (XTH-11).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl"	--NA--	ASKIEGCKTEFMGIDKCTDPKFWWNRKQLSSKEKTLYLNARKTYLDYDYCKNSGSGFESQLIYGSGYFNVRIKAPQTTSTGVITSFYLISRSSRHDELCFMVMVVVAVVAAAQGQEETTGFVTWGNNYYQTWGHQALVINKTSELQLTLDQILGKNGPPYLLNTNMYLYGEGGKDQRFRLWFDPTKDYHSYSFLWNPNQLSDRQRYPKVPQECGSYTVFYVDDTPIRVYSKNPDVYYPSVQTMFLMGSVQNGSIIDPKQMPYIAKFQ	267	"Experimental evidence at transcript level"	30796.88	30777.11	8.63	--NA--	"FUNCTION:May catalyze xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity).CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 1 subfamily.CAUTION:In contrast to other xyloglucan endotransglucosylase proteins, the catalytic motif is atypical and lacks the proton donor site. It therefore may not be functional in vivo.WEB RESOURCE:Name=XTH-World; URL=""http://labs.plantbio.cornell.edu/XTH/""; "