PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4596	THN21_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Plant defense; Plant toxin; Secreted; Signal; Toxin | Thionin-2.1 precursor [Contains: Thionin-2.1; Acidic protein].Secreted (Potential)."	--NA--	ASEIVNGASEQCAKGCSIFCTKSYVVPPGPPKLLMKGRILILSLLIMSLVMAQVQVEAKICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVNAILENSADATNEHCKLGCETSVCGAMNTLQNSD	134	"Experimental evidence at transcript level"	14350.68	14340.92	8.49	--NA--	"FUNCTION:Seems to function as a defense factor. Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.TISSUE SPECIFICITY:Detected in rosette leaves and at a very high level in flowers and in siliques.INDUCTION:Highly induced in seedlings by pathogens, wounding, silver nitrate, and methyl jasmonate.SIMILARITY:Belongs to the plant thionin (TC 1.C.44) family."