PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4552	DEF2_PETHY	--NA--	"Petunia hybrida"	Solanaceae	--NA--	Signaling-peptide	"Antimicrobial; Direct protein sequencing; Fungicide; Knottin; Plant defense; Signal; Vacuole | Floral defensin-like protein 2 precursor (PhD2).Vacuole (By similarity)."	--NA--	AQPEKFTDGHCSKILRRCLCTKPCATEEATATLANEVKTMAEALVEEDMMEMARSICFFAVAILALMLFAAYETEAGTCKAECPTWEGICINKAPCVKCCK	101	"Experimental evidence at protein level"	11049.03	11041.21	5.16	--NA--	"FUNCTION:Plant defense peptide with antifungal activity against F.oxysporum and B.cinerea.BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Stable under extremes of pH; Temperature dependence: Stable under extremes of temperature;TISSUE SPECIFICITY:Petals.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin (By similarity).PTM:When compared to other plant defensins, the petunia defensins have an additional fifth disulfide bond.SIMILARITY:Belongs to the plant defensin family."