PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4521	AGP19_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Glycoprotein; GPI-anchor; Lipoprotein; Membrane; Proteoglycan; Pyrrolidone carboxylic acid; Signal | Lysine-rich arabinogalactan protein 19 precursor (Lys-rich AGP 19).Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	APPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPMESNSIIWSLLLASALISSFSVNAQGPAASPVTSTTTAPPPTTAAPPTTAPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPPVLTDPQDTAPAPSPNTVTIQYVSPPPVQAPSPISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSP	222	"Experimental evidence at transcript level"	21805.9	21792.45	10.12	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.TISSUE SPECIFICITY:Strongly expressed in stems, moderately expressed in flowers and roots and weakly expressed in young leaves.PTM:O-glycosylated on the hydroxyproline residues (By similarity).SIMILARITY:Belongs to the lysine-rich AGP family."