PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4516	EXPB1_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Allergen; Cell wall; Cell wall biogenesis/degradation; Glycoprotein; Membrane; Secreted; Signal | Expansin-B1 precursor (OsEXPB1) (Beta-expansin-1) (OsaEXPb1.2),(OsaEXPb1.3) (Major pollen allergen Ory s 1) (Ory s I).Secreted, cell wall; Peripheral membrane protein (By similarity)."	--NA--	APKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIMASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGPDGWKADSVYKSNVQAKSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKA	267	"Experimental evidence at protein level"	28626.75	28608.31	6.4	--NA--	"FUNCTION:May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity).TISSUE SPECIFICITY:Expressed in mature anthers but not in vegetative or other floral tissues.ALLERGEN:Causes an allergic reaction in human. Causes grass pollen allergy. Binds to IgE.SIMILARITY:Belongs to the expansin family. Expansin B subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain.SEQUENCE CAUTION:Sequence=AAA86533.1; Type=Frameshift; Positions=Several; Sequence=AAA86533.1; Type=Miscellaneous discrepancy; Note=Sequencing errors; "