PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4513	AGP1_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Glycoprotein; GPI-anchor; Lipoprotein; Membrane; Proteoglycan; Pyrrolidone carboxylic acid; Signal | Classical arabinogalactan protein 1 precursor.Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	APGPAQGGAVSNKFASFGSVAVMLTAAVLVIMAFSKSLVFVLLAALLISSAVAQSPAPAPSNVGGRRISPAPSPKKMTAPAPAPEVSPSPSPAAALTPESSASPPSPPLADSPTADSPALSPSAISDSPTE	131	"Experimental evidence at transcript level"	12637.46	12629.57	6.34	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.TISSUE SPECIFICITY:Predominantly expressed in flowers and at a lower level in roots and leaves.PTM:O-glycosylated on the hydroxyproline residues (By similarity).SIMILARITY:Belongs to the classical AGP family."