PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4507	GL23_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Complete proteome; Glycoprotein; Manganese; Metal-binding; Secreted; Signal | Germin-like protein subfamily 2 member 3 precursor.Secreted, extracellular space, apoplast (By similarity)."	--NA--	APGGLNPPHLHPRASEAIFVLEGRLFVGFLTTTGKLISKHVNKGDVFVFPFGAAAPEIQKIKGKFPPKKKALLHFQQNPNKAPASVLAAFDSQLPGTQVVGPSLFGSNPPIPDDLLAKAKVTPEDFYFIGLATAAATANSSMGSAVTGANVEKVPGLNTLGVSISRIDYMATSMIPIFVTFMLVAAHMALADTNMLQDFCVADLSNGLKVNGYPCKDPA	219	"Experimental evidence at transcript level"	23032.76	23018.02	8.86	--NA--	"FUNCTION:May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.SUBUNIT:Oligomer (believed to be a pentamer but probably hexamer) (By similarity).SIMILARITY:Belongs to the germin family."
