PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4484	THN_BRARP	--NA--	"Brassica rapa subsp. pekinensis"	Brassicaceae	--NA--	Signaling-peptide	"Plant defense; Plant toxin; Signal; Toxin | Thionin precursor [Contains: Thionin; Acidic protein]."	--NA--	ANLSGCKIVSGTTCPPGYTHDILQNYGDAVNEYCKLGCASSVCGALTTLKMEGKTVILGVIIMSLVMAQNQVEAKICCPRTIDRNIYNACRLTGASMTNCNSMQVNCEGAVSQCTNACSNFCTKGSAKVVETA	133	"Experimental evidence at transcript level"	13961.14	13951.57	8	--NA--	"FUNCTION:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.TISSUE SPECIFICITY:Expressed in flowers.SIMILARITY:Belongs to the plant thionin (TC 1.C.44) family."