PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4483	PR06_SOLLC	--NA--	"Solanum lycopersicum, Lycopersicon esculentum"	Solanaceae	--NA--	Signaling-peptide	"3D-structure; Antimicrobial; Direct protein sequencing; Fungicide; Pathogenesis-related protein; Plant defense; Pyrrolidone carboxylic acid; Signal | Pathogenesis-related leaf protein 6 precursor (P6) (Ethylene-induced,protein P1) (P14) (P14A) (PR protein)."	--NA--	ANLASRAQNYANSRAGDCNLIHSGAGENLAKGGGDFTGRAAVQLWVSERPGNWIGQRPYMGLFNISLLLTCLMVLAIFHSCEAQNSPQDYLAVHNDARAQVGVGPMSWDSYNYATNQCVGGKKCRHYTQVVWRNSVRLGCGRARCNNGWWFISCNYDPV	159	"Experimental evidence at protein level"	17519.73	17508.38	8.86	--NA--	"FUNCTION:Probably involved in the defense reaction of plants against pathogens. Has antifungal activity.DEVELOPMENTAL STAGE:Maximum expression found during days 4 to 8 and days 8 to 12 after inoculation with an avirulent and a virulent pathogen respectively.INDUCTION:Upon infection by virulent and avirulent races of pathogens, for example fungal pathogen C.fulvum. Also induced by ethylene.SIMILARITY:Belongs to the CRISP family."