PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4482	PR04_SOLLC	--NA--	"Solanum lycopersicum, Lycopersicon esculentum"	Solanaceae	--NA--	Signaling-peptide	"Pathogenesis-related protein; Plant defense; Pyrrolidone carboxylic acid; Signal | Pathogenesis-related leaf protein 4 precursor (P4)."	--NA--	ANLASRAQNYANSRAGDCNLIHSGAGENLAKGGGDFTGRAAVQLWVSERPDYNYATNQCVGGKMCGHYTQVVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWVGERPYMGLFNISLLLTCLMVLAIFHSCEAQNSPQDYLAVHNDARAQVGVGPMSWD	159	"Experimental evidence at transcript level"	17438.58	17427.21	7.75	--NA--	"FUNCTION:Probably involved in the defense reaction of plants against pathogens.DEVELOPMENTAL STAGE:Maximum expression found during days 4 to 8 and days 8 to 12 after inoculation with an avirulent and a virulent pathogen respectively.INDUCTION:Upon infection by virulent and avirulent races of pathogens, for example fungal pathogen C.fulvum.SIMILARITY:Belongs to the CRISP family."