PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4436	IAAD_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"Alpha-amylase inhibitor; Direct protein sequencing; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Alpha-amylase/trypsin inhibitor CMd precursor (Chloroform/methanol-,soluble protein CMd).Secreted."	--NA--	ALRYFMALPVPSQPVDPSTGNVGQSGLMDLPGCPREMQRDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWILQQTCAVFTPGSKLPEWMTSAELNYPGQPYLAKLYCCQELAEIPQQCRCEMACKSSRSLLLLATVMVSVFAAAAAAAAATDCSPGVAFPTNLLGHCRDYV	171	"Experimental evidence at protein level"	18525.58	18513.08	6.11	--NA--	"FUNCTION:Part of a complex with inhibitory activity, but CMd is inactive as a separate subunit.SUBUNIT:Heterotetramer of one CMa, one CMb and two CMd chains.TISSUE SPECIFICITY:Endosperm.PTM:Five disulfide bonds are present (Probable), which are essential for the inhibitor activity.SIMILARITY:Belongs to the protease inhibitor I6 (cereal trypsin/alpha-amylase inhibitor) family."