PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4401	ASF2_HELAN	--NA--	"Helianthus annuus"	Asteraceae	--NA--	Signaling-peptide	"Cell wall; Cell wall biogenesis/degradation; Glycoprotein; Secreted; Signal | Anther-specific protein SF2 precursor."	--NA--	AKVENVMLPGQKNMNCTQCPKMANNSVSYLVLLLLVFVLAISESAPVQYCDRVTNLYHEKCDEKQCTEHCKTNEKAESGYCLVVEKQQLSICSFDCSKYKPSTPAPPPPPPKLFYSGSWLQ	121	"Experimental evidence at transcript level"	13565.71	13556.59	7.68	--NA--	"FUNCTION:Anther-specific cell wall protein which could contribute to the cell wall architecture of epidermal anther cells via intermolecular disulfide bridges.TISSUE SPECIFICITY:Epidermal anther cells.DEVELOPMENTAL STAGE:Late developmental stages."