PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4363	PER43_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Calcium; Complete proteome; Glycoprotein; Heme; Hydrogen peroxide; Iron; Metal-binding; Oxidoreductase; Peroxidase; Secreted; Signal | Peroxidase 43 precursor (EC 1.11.1.7) (Atperox P43).Secreted (By similarity)."	--NA--	AIVKMGKIGVKTGFKGEIRRVCSAFNKRLYDFLPGGQPDPTINPTFLPELTTQCPQNGDINVRLPIDRFSERLFDKLSDPNLPAILLRLHFHDCFVEGCDGSILVNNGAISEKNAFGHEGVRGFEIMVWANAKMRLALSLVTVFFGISLANLEVGFYSNTCPQAESIVKRVVSGAANMSLAKDMPEVSDSIEILKAKFMQKGLNAKDLVLLSAAHTIGTTACFFMSQILQNIKDGFAVLQTDAGLYEDVTTRQVVDSYLGMLNPFFGPTFESDFVKVEAVKAELEAACPGVVSCSDIVALAARDAISLANGPAYEVPTGRRDGRVS	326	"Protein inferred from homology"	35364.77	35342.08	5.69	--NA--	"FUNCTION:Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.CATALYTIC ACTIVITY:Donor H(2)O(2) = oxidized donor 2 H(2)O.COFACTOR:Binds 1 heme B (iron-protoporphyrin IX) group per subunit (By similarity).COFACTOR:Binds 2 calcium ions per subunit (By similarity).MISCELLANEOUS:There are 73 peroxidase genes in A.thaliana.SIMILARITY:Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily."
