PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4328	CALR_PRUAR	--NA--	"Prunus armeniaca"	Rosaceae	--NA--	Signaling-peptide	"Calcium; Chaperone; Endoplasmic reticulum; Glycoprotein; Lectin; Metal-binding; Repeat; Signal; Zinc | Calreticulin precursor.Endoplasmic reticulum lumen (By similarity)."	--NA--	AILNYNNTNNLIKKDVPCETDQLTHVYTFIIRPDATYSILIDNLEKQTGSDNPEFKDDPELYVYPNLKYVGIELWQVKSGTLFDNILITDEPEYAKQLAEESKPDSTEESAETEAEKHDELETWGKQKDAEKAAFEELEKKLQEEESKEDPVDSDAEDDDNEAEDGEESDSLAGEWNYTSGKWNGDPNDKGIQTSEDYRFYAISAEFPEFSNKDKTLVFQFLYSDWDLLPAKKIKDPEAKKPEDWEDQEYIPDPEDKKPEGYDDIPKEITDMAFRVPNSSLLSLILLSLLAIASAKVFFEERFEDGWDKRWVTSEWKKDENPDAKKPEDWDDEEDGEWTAPTIPNPEYKGEWKPKKIKNPNFKGKWKAPLISVKHEQKLDCGGGYIKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVH	421	"Experimental evidence at transcript level"	48416.3	48386.46	4.4	--NA--	"FUNCTION:Molecular calcium binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER (By similarity).DOMAIN:Can be divided into a N-terminal globular domain, a proline-rich P-domain forming an elongated arm-like structure and a C-terminal acidic domain. The P-domain binds one molecule of calcium with high affinity, whereas the acidic C-domain binds multiple calcium ions with low affinity (By similarity).DOMAIN:The interaction with glycans occurs through a binding site in the globular lectin domain (By similarity).DOMAIN:The zinc binding sites are localized to the N-domain (By similarity).SIMILARITY:Belongs to the calreticulin family."
